Loading...
Statistics
Am Tonberg – Reiseblog | …mit der Familie unterwegs
www.amtonberg.com/
Auf den folgenden Seiten haben wir einige unserer Urlaubsreisen dokumentiert. 2016 Breslau, Krakau, Zakopane (PL) 2015 Lago di Garda und Milano (I) ...
Amtonberg.com
Amtonberg.com is hosted in
United States
/
San Francisco
.
Amtonberg.com uses HTTPS protocol.
Number of used technologies:
7.
First technologies:
CSS, Gravatar, Html,
Number of used javascripts: 7.
First javascripts:
Gprofiles.js, Wpgroho.js, Jquery.autoresize.js,
Number of used analytics tools:
1.
First analytics tools:
ComScore,
Its server type is:
nginx.
Its CMS is:
Wordpress.
Technologies in use by Amtonberg.com
Technology
Number of occurences: 7
- CSS
- Gravatar
- Html
- Html5
- Javascript
- Php
- Pingback
Advertisement
Javascripts
Number of occurences: 7
- gprofiles.js
- wpgroho.js
- jquery.autoresize.js
- script.js
- form.js
- 725X1342.skimlinks.js
- w.js
Content Management System
Number of occurences: 1
- Wordpress
Analytics
Number of occurences: 1
- comScore
Advertise
Number of occurences: 1
- Skimlinks
Server Type
- nginx
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Not founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Not founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Amtonberg.com
SSL certificate
- name: /CN=tls.automattic.com
- subject:
- CN: tls.automattic.com
- hash: 6338c477
- issuer:
- C: US
- O: Let's Encrypt
- CN: Let's Encrypt Authority X3
- version: 2
- serialNumber: 305824697402169823231304834028145237636840
- validFrom: 160404105900Z
- validTo: 160703105900Z
- validFrom_time_t: 1459767540
- validTo_time_t: 1467543540
- extensions:
- keyUsage: Digital Signature, Key Encipherment
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- basicConstraints: CA:FALSE
- subjectKeyIdentifier: 87:31:32:E9:5B:BB:9F:C8:1F:62:6D:1C:ED:86:04:10:53:63:F0:5B
- authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
- authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
- subjectAltName: DNS:amsterdampornguide.com, DNS:amsterdamprivateboattour.com, DNS:amsterdamrxp.com, DNS:amsterdamsel.com, DNS:amsterdamspurs.com, DNS:amsterdamwhitneygallery.com, DNS:amsterdogblog.com, DNS:amsthinktank.com, DNS:amstohr.com, DNS:amsuganda.org, DNS:amtaes-asociacion.com, DNS:amtales.com, DNS:amtastudentblog.com, DNS:amtaxidermy.com, DNS:amtayouradvantage.com, DNS:amtbvancouver.com, DNS:amtea.net, DNS:amtextilesolutions.com, DNS:amtfdizi.com, DNS:amtgala.com, DNS:amth.org, DNS:amthirdpartyreport.com, DNS:amthompson.net, DNS:amtice.com, DNS:amtlecolemusique.com, DNS:amtlive.org, DNS:amtlpaul.com, DNS:amtonberg.com, DNS:amtphotographynyc.com, DNS:amtrakcareersnewsletter.com, DNS:amtrakmarketfridaysweepstakes.com, DNS:amtraknews.com, DNS:amtraveltimes.com, DNS:amtup.net, DNS:amtuusimaa.net, DNS:amtzweinull.com, DNS:amuciq.org, DNS:amuddylife.com, DNS:amuddymess.com, DNS:amughalffull.com, DNS:amulet-project.org, DNS:amulethunter.com, DNS:amuletsbymerlin.me, DNS:amuletstrange.com, DNS:amulmago.com, DNS:amulyabodden.com, DNS:amulyadatla.com, DNS:amulyagopalakrishnan.com, DNS:amumandotherthings.com, DNS:amumediation.com, DNS:tls.automattic.com
- certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/
Number of occurences: 12
- Name:
Content: https://www.facebook.com/WordPresscom - Name: generator
Content: WordPress.com - Name: twitter:site
Content: @wordpressdotcom - Name: twitter:image
Content: https://secure.gravatar.com/blavatar/039a06d705102f473df054e607e7f905?s=240 - Name: twitter:card
Content: summary - Name: theme-color
Content: #1b2b4f - Name: application-name
Content: Am Tonberg - Reiseblog - Name: msapplication-window
Content: width=device-width;height=device-height - Name: msapplication-tooltip
Content: ...mit der Familie unterwegs - Name: msapplication-task
Content: name=WordPress.com-Foren;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico - Name: title
Content: Willkommen | Am Tonberg - Reiseblog bei WordPress.com - Name: description
Content: Auf den folgenden Seiten haben wir einige unserer Urlaubsreisen dokumentiert. 2016 Breslau, Krakau, Zakopane (PL) 2015 Lago di Garda und Milano (I) Andalusien (E) 2014 Istanbul (TR) London und Edinburgh (GB) 2012 Wien (A) Prag (CZ) Paris (F) Weitere Reiseziele stehen rechts unter "Destinations"
Server / Hosting
- IP: 192.0.78.24
- Latitude: 37.75
- Longitude: -122.42
- Country: United States
- City: San Francisco
Rname
- ns1.wordpress.com
- ns2.wordpress.com
- ns3.wordpress.com
Target
- hostmaster.wordpress.com
HTTP Header Response
HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Wed, 27 Apr 2016 17:00:19 GMT
Content-Type: text/html
Content-Length: 178
Connection: keep-alive
Location: https://amtonberg.com/
X-ac: 3.ams _dca
HTTP/1.1 200 OK
Server: nginx
Date: Wed, 27 Apr 2016 17:00:19 GMT
Content-Type: text/html; charset=UTF-8
Connection: keep-alive
Strict-Transport-Security: max-age=86400
Vary: Accept-Encoding
Vary: Cookie
X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
X-Pingback: https://amtonberg.com/xmlrpc.php
Link: ; rel=shortlink
X-ac: 3.ams _dca
DNS
host: amtonberg.com
- class: IN
- ttl: 298
- type: A
- ip: 192.0.78.25
host: amtonberg.com
- class: IN
- ttl: 298
- type: A
- ip: 192.0.78.24
host: amtonberg.com
- class: IN
- ttl: 86400
- type: NS
- target: ns1.wordpress.com
host: amtonberg.com
- class: IN
- ttl: 86400
- type: NS
- target: ns2.wordpress.com
host: amtonberg.com
- class: IN
- ttl: 86400
- type: NS
- target: ns3.wordpress.com
host: amtonberg.com
- class: IN
- ttl: 86400
- type: SOA
- mname: ns1.wordpress.com
- rname: hostmaster.wordpress.com
- serial: 2005071858
- refresh: 14400
- retry: 7200
- expire: 604800
- minimum-ttl: 300
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.mtonberg.com, www.aomtonberg.com, www.omtonberg.com, www.apmtonberg.com, www.pmtonberg.com, www.a9mtonberg.com, www.9mtonberg.com, www.amtonberg.com, www.mtonberg.com, www.aimtonberg.com, www.imtonberg.com, www.aumtonberg.com, www.umtonberg.com, www.atonberg.com, www.amptonberg.com, www.aptonberg.com, www.amotonberg.com, www.aotonberg.com, www.amitonberg.com, www.aitonberg.com, www.amktonberg.com, www.aktonberg.com, www.am.tonberg.com, www.a.tonberg.com, www.amutonberg.com, www.autonberg.com, www.amjtonberg.com, www.ajtonberg.com, www.amntonberg.com, www.antonberg.com, www.am-tonberg.com, www.a-tonberg.com, www.amonberg.com, www.amtqonberg.com, www.amqonberg.com, www.amtaonberg.com, www.amaonberg.com, www.amt onberg.com, www.am onberg.com, www.amtwonberg.com, www.amwonberg.com, www.amteonberg.com, www.ameonberg.com, www.amtzonberg.com, www.amzonberg.com, www.amtxonberg.com, www.amxonberg.com, www.amtconberg.com, www.amconberg.com, www.amtnberg.com, www.amtobnberg.com, www.amtbnberg.com, www.amtohnberg.com, www.amthnberg.com, www.amtognberg.com, www.amtgnberg.com, www.amtojnberg.com, www.amtjnberg.com, www.amtomnberg.com, www.amtmnberg.com, www.amto nberg.com, www.amt nberg.com, www.amtovnberg.com, www.amtvnberg.com, www.amtoberg.com, www.amtonnberg.com, www.amtonberg.com, www.amtonhberg.com, www.amtohberg.com, www.amtonjberg.com, www.amtojberg.com, www.amtonkberg.com, www.amtokberg.com, www.amtonlberg.com, www.amtolberg.com, www.amton berg.com, www.amto berg.com, www.amtonerg.com, www.amtonbqerg.com, www.amtonqerg.com, www.amtonbwerg.com, www.amtonwerg.com, www.amtonbzerg.com, www.amtonzerg.com, www.amtonbxerg.com, www.amtonxerg.com, www.amtonberg.com, www.amtonerg.com, www.amtonbserg.com, www.amtonserg.com, www.amtonbyerg.com, www.amtonyerg.com, www.amtonbeerg.com, www.amtoneerg.com, www.amtonbderg.com, www.amtonderg.com, www.amtonbcerg.com, www.amtoncerg.com, www.amtonbrg.com, www.amtonbexrg.com, www.amtonbxrg.com, www.amtonbesrg.com, www.amtonbsrg.com, www.amtonbewrg.com, www.amtonbwrg.com, www.amtonberrg.com, www.amtonbrrg.com, www.amtonbefrg.com, www.amtonbfrg.com, www.amtonbevrg.com, www.amtonbvrg.com, www.amtonbecrg.com, www.amtonbcrg.com, www.amtonbeqrg.com, www.amtonbqrg.com, www.amtonbearg.com, www.amtonbarg.com, www.amtonbeyrg.com, www.amtonbyrg.com, www.amtonbeg.com, www.amtonberig.com, www.amtonbeig.com, www.amtonberog.com, www.amtonbeog.com, www.amtonberlg.com, www.amtonbelg.com, www.amtonberlg.com, www.amtonbelg.com, www.amtonber.g.com, www.amtonbe.g.com, www.amtonber.com, www.amtonbergs.com, www.amtonbers.com, www.amtonbergx.com, www.amtonberx.com, www.amtonbergy.com, www.amtonbery.com, www.amtonbergh.com, www.amtonberh.com, www.amtonbergn.com, www.amtonbern.com, www.amtonbergc.com, www.amtonberc.com, www.amtonbergd.com, www.amtonberd.com, www.amtonberge.com, www.amtonbere.com, www.amtonbergr.com, www.amtonberr.com, www.amtonbergt.com, www.amtonbert.com, www.amtonbergb.com, www.amtonberb.com, www.amtonbergv.com, www.amtonberv.com,
Other websites we recently analyzed
- Equiambiente S.A.
WOWSlider created with WOW Slider, a free wizard program that helps you easily generate beautiful web slideshowSantiago (Chile) - 201.148.104.110
Server software: Apache
Technology: CSS, Font Awesome, Html, Iframe, Javascript, jQuery
Number of Javascript: 3
Number of meta tags: 3 - Sistar Pest Control
Pest, Termite, and Moisture Control SpecialistUnited States - 75.98.17.74
Server software: Webs.com/1.0
Technology: CSS, Google Font API, Html, Html5, Javascript, Google Analytics
Number of Javascript: 7
Number of meta tags: 5 - Elite Product Reviews - Best Health Products Reviewed by Professionals
Best Health Products Reviewed by ProfessionalsTulsa (United States) - 23.238.20.167
Server software: LiteSpeed
Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Cycle, Php, Pingback, W3 Total cache, Google Analytics, Wordpress
Number of Javascript: 6
Number of meta tags: 8 - Abis African Restaurant - Syracuse | View our menu, reviews & Order food online
View our menu and reviews for Abis African Restaurant located at 717 N Salina St - Syracuse. Abi's is a family owned restaurant serving the Syracuse communityOak Brook (United States) - 68.169.206.175
Server software:
Technology: CSS, Html, Iframe, Javascript
Number of Javascript: 2
Number of meta tags: 8 - weedeats.com
Ashburn (United States) - 54.175.122.20
Server software: Microsoft-IIS/8.0
Technology: CSS, Html, Javascript, StatCounter
Number of meta tags: 1 - 0324323638 - Organizational Behavior (with CD-ROM and InfoTrac 1-Semester Printed Access Card)
Scottsdale (United States) - 68.178.212.209
Server software: Apache
Technology: CSS, Html, Javascript
Number of meta tags: 1 - Credit Card and Payment Processing Solutions - AIB Merchant Services
AIB Merchant Services is one of Ireland’s largest providers of payment solutions. We process millions of payments every day, and deal with every major credit and debit card accepting payments in every channel we can.Cambridge (United States) - 70.42.52.178
Server software: Apache
Technology: CSS, Fancybox, Html, Iframe, Javascript, jQuery, jQuery Fancybox, Php, Pingback, W3 Total cache, Google Tagmanager, Wordpress
Number of Javascript: 8
Number of meta tags: 8 - Pita Safaris - Discover the Pearl of Africa
Provo (United States) - 50.87.160.109
Server software: Apache
Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Html, Html5, Javascript, SVG
Number of Javascript: 6
Number of meta tags: 5 - flatswap.co.uk
United Kingdom - 94.136.40.82
Server software: Microsoft-IIS/7.5
Technology: Html - pianolessonsedinburgh.com
United Kingdom - 109.68.33.18
Server software: Microsoft-IIS/7.0
Technology: CSS, Html, Javascript, Php
Number of Javascript: 1
Number of meta tags: 1