Loading...
Statistics
Advertisement

Am Tonberg – Reiseblog | …mit der Familie unterwegs
www.amtonberg.com/
Auf den folgenden Seiten haben wir einige unserer Urlaubsreisen dokumentiert. 2016 Breslau, Krakau, Zakopane (PL) 2015 Lago di Garda und Milano (I) ...

Amtonberg.com

Advertisement
Amtonberg.com is hosted in United States / San Francisco . Amtonberg.com uses HTTPS protocol. Number of used technologies: 7. First technologies: CSS, Gravatar, Html, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Amtonberg.com

Technology

Number of occurences: 7
  • CSS
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • form.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Amtonberg.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 305824697402169823231304834028145237636840
    • validFrom: 160404105900Z
    • validTo: 160703105900Z
    • validFrom_time_t: 1459767540
    • validTo_time_t: 1467543540
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 87:31:32:E9:5B:BB:9F:C8:1F:62:6D:1C:ED:86:04:10:53:63:F0:5B
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:amsterdampornguide.com, DNS:amsterdamprivateboattour.com, DNS:amsterdamrxp.com, DNS:amsterdamsel.com, DNS:amsterdamspurs.com, DNS:amsterdamwhitneygallery.com, DNS:amsterdogblog.com, DNS:amsthinktank.com, DNS:amstohr.com, DNS:amsuganda.org, DNS:amtaes-asociacion.com, DNS:amtales.com, DNS:amtastudentblog.com, DNS:amtaxidermy.com, DNS:amtayouradvantage.com, DNS:amtbvancouver.com, DNS:amtea.net, DNS:amtextilesolutions.com, DNS:amtfdizi.com, DNS:amtgala.com, DNS:amth.org, DNS:amthirdpartyreport.com, DNS:amthompson.net, DNS:amtice.com, DNS:amtlecolemusique.com, DNS:amtlive.org, DNS:amtlpaul.com, DNS:amtonberg.com, DNS:amtphotographynyc.com, DNS:amtrakcareersnewsletter.com, DNS:amtrakmarketfridaysweepstakes.com, DNS:amtraknews.com, DNS:amtraveltimes.com, DNS:amtup.net, DNS:amtuusimaa.net, DNS:amtzweinull.com, DNS:amuciq.org, DNS:amuddylife.com, DNS:amuddymess.com, DNS:amughalffull.com, DNS:amulet-project.org, DNS:amulethunter.com, DNS:amuletsbymerlin.me, DNS:amuletstrange.com, DNS:amulmago.com, DNS:amulyabodden.com, DNS:amulyadatla.com, DNS:amulyagopalakrishnan.com, DNS:amumandotherthings.com, DNS:amumediation.com, DNS:tls.automattic.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Amtonberg.com

Number of occurences: 12
  • Name:
    Content: https://www.facebook.com/WordPresscom
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: twitter:image
    Content: https://secure.gravatar.com/blavatar/039a06d705102f473df054e607e7f905?s=240
  • Name: twitter:card
    Content: summary
  • Name: theme-color
    Content: #1b2b4f
  • Name: application-name
    Content: Am Tonberg - Reiseblog
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: ...mit der Familie unterwegs
  • Name: msapplication-task
    Content: name=WordPress.com-Foren;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: Willkommen | Am Tonberg - Reiseblog bei WordPress.com
  • Name: description
    Content: Auf den folgenden Seiten haben wir einige unserer Urlaubsreisen dokumentiert. 2016 Breslau, Krakau, Zakopane (PL) 2015 Lago di Garda und Milano (I) Andalusien (E) 2014 Istanbul (TR) London und Edinburgh (GB) 2012 Wien (A) Prag (CZ) Paris (F) Weitere Reiseziele stehen rechts unter "Destinations"

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns1.wordpress.com
  • ns2.wordpress.com
  • ns3.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Wed, 27 Apr 2016 17:00:19 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Location: https://amtonberg.com/ X-ac: 3.ams _dca HTTP/1.1 200 OK Server: nginx Date: Wed, 27 Apr 2016 17:00:19 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. X-Pingback: https://amtonberg.com/xmlrpc.php Link: ; rel=shortlink X-ac: 3.ams _dca

DNS

host: amtonberg.com
  1. class: IN
  2. ttl: 298
  3. type: A
  4. ip: 192.0.78.25
host: amtonberg.com
  1. class: IN
  2. ttl: 298
  3. type: A
  4. ip: 192.0.78.24
host: amtonberg.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: amtonberg.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: amtonberg.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: amtonberg.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.mtonberg.com, www.aomtonberg.com, www.omtonberg.com, www.apmtonberg.com, www.pmtonberg.com, www.a9mtonberg.com, www.9mtonberg.com, www.amtonberg.com, www.mtonberg.com, www.aimtonberg.com, www.imtonberg.com, www.aumtonberg.com, www.umtonberg.com, www.atonberg.com, www.amptonberg.com, www.aptonberg.com, www.amotonberg.com, www.aotonberg.com, www.amitonberg.com, www.aitonberg.com, www.amktonberg.com, www.aktonberg.com, www.am.tonberg.com, www.a.tonberg.com, www.amutonberg.com, www.autonberg.com, www.amjtonberg.com, www.ajtonberg.com, www.amntonberg.com, www.antonberg.com, www.am-tonberg.com, www.a-tonberg.com, www.amonberg.com, www.amtqonberg.com, www.amqonberg.com, www.amtaonberg.com, www.amaonberg.com, www.amt onberg.com, www.am onberg.com, www.amtwonberg.com, www.amwonberg.com, www.amteonberg.com, www.ameonberg.com, www.amtzonberg.com, www.amzonberg.com, www.amtxonberg.com, www.amxonberg.com, www.amtconberg.com, www.amconberg.com, www.amtnberg.com, www.amtobnberg.com, www.amtbnberg.com, www.amtohnberg.com, www.amthnberg.com, www.amtognberg.com, www.amtgnberg.com, www.amtojnberg.com, www.amtjnberg.com, www.amtomnberg.com, www.amtmnberg.com, www.amto nberg.com, www.amt nberg.com, www.amtovnberg.com, www.amtvnberg.com, www.amtoberg.com, www.amtonnberg.com, www.amtonberg.com, www.amtonhberg.com, www.amtohberg.com, www.amtonjberg.com, www.amtojberg.com, www.amtonkberg.com, www.amtokberg.com, www.amtonlberg.com, www.amtolberg.com, www.amton berg.com, www.amto berg.com, www.amtonerg.com, www.amtonbqerg.com, www.amtonqerg.com, www.amtonbwerg.com, www.amtonwerg.com, www.amtonbzerg.com, www.amtonzerg.com, www.amtonbxerg.com, www.amtonxerg.com, www.amtonberg.com, www.amtonerg.com, www.amtonbserg.com, www.amtonserg.com, www.amtonbyerg.com, www.amtonyerg.com, www.amtonbeerg.com, www.amtoneerg.com, www.amtonbderg.com, www.amtonderg.com, www.amtonbcerg.com, www.amtoncerg.com, www.amtonbrg.com, www.amtonbexrg.com, www.amtonbxrg.com, www.amtonbesrg.com, www.amtonbsrg.com, www.amtonbewrg.com, www.amtonbwrg.com, www.amtonberrg.com, www.amtonbrrg.com, www.amtonbefrg.com, www.amtonbfrg.com, www.amtonbevrg.com, www.amtonbvrg.com, www.amtonbecrg.com, www.amtonbcrg.com, www.amtonbeqrg.com, www.amtonbqrg.com, www.amtonbearg.com, www.amtonbarg.com, www.amtonbeyrg.com, www.amtonbyrg.com, www.amtonbeg.com, www.amtonberig.com, www.amtonbeig.com, www.amtonberog.com, www.amtonbeog.com, www.amtonberlg.com, www.amtonbelg.com, www.amtonberlg.com, www.amtonbelg.com, www.amtonber.g.com, www.amtonbe.g.com, www.amtonber.com, www.amtonbergs.com, www.amtonbers.com, www.amtonbergx.com, www.amtonberx.com, www.amtonbergy.com, www.amtonbery.com, www.amtonbergh.com, www.amtonberh.com, www.amtonbergn.com, www.amtonbern.com, www.amtonbergc.com, www.amtonberc.com, www.amtonbergd.com, www.amtonberd.com, www.amtonberge.com, www.amtonbere.com, www.amtonbergr.com, www.amtonberr.com, www.amtonbergt.com, www.amtonbert.com, www.amtonbergb.com, www.amtonberb.com, www.amtonbergv.com, www.amtonberv.com,

Other websites we recently analyzed

  1. Fashion Tips And Advice
    The market and styles of sunglasses are driven by popular fashion and show biz world. In fact as soon as a pair is worn by a celebrity it is a sure way of
    Houston (United States) - 192.185.160.62
    Server software: nginx/1.10.1
    Technology: Google Adsense, CSS, Html, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 11
    Number of meta tags: 7
  2. shengsibank.com
    See related links to what you are looking for.
    New York (United States) - 199.59.243.120
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, Html, Html5, Javascript
    Number of meta tags: 3
  3. Lost Places
    Interesting, abandoned, lonely and horrorful places all over the world. Submit your places!
    New York (United States) - 66.6.43.21
    Server software: nginx
    Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, Php, Google Analytics, Tumblr, Facebook Like box
    Number of Javascript: 3
    Number of meta tags: 23
  4. Karizma Builders
    Scottsdale (United States) - 166.62.28.125
    Server software: Apache/2.4.12
    Technology: CSS, Html
    Number of meta tags: 1
  5. www.praxis-dr-senska.de
    Hamburg (Germany) - 212.53.129.8
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  6. Gold Coast Carpet Clean
    Australia - 27.124.120.1
    Server software: nginx
    Technology: CSS, Html, Javascript
    Number of meta tags: 1
  7. AKME Ingénierie
    Akme ingénierie Versailles Maurepas ile de France
    France - 62.210.16.62
    Server software: nginx
    Technology: CSS, Html, Javascript
    Number of Javascript: 5
    Number of meta tags: 4
  8. goaltriggerapp.com
    Wayne (United States) - 74.208.215.69
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  9. Willkommen bei Ruhmann.de
    Germany - 31.170.104.133
    Server software: Apache/2.2.31
    Technology: CSS, Html, Php
    Number of meta tags: 1
  10. elenamatematicas.es - Diese Website steht zum Verkauf! - Informationen zum Thema elenamatematicas.
    Diese Website steht zum Verkauf! elenamatematicas.es ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf elenamatematicas.es alles. Wir hoffen, dass Sie hier das Gesuchte finden!
    Cambridge (United States) - 72.52.4.119
    Server software: Apache/2.2.22 (Debian)
    Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 5

Check Other Websites