Loading...
Statistics
Am Tonberg – Reiseblog | …mit der Familie unterwegs
www.amtonberg.com/
Auf den folgenden Seiten haben wir einige unserer Urlaubsreisen dokumentiert. 2016 Breslau, Krakau, Zakopane (PL) 2015 Lago di Garda und Milano (I) ...
Amtonberg.com
Amtonberg.com is hosted in
United States
/
San Francisco
.
Amtonberg.com uses HTTPS protocol.
Number of used technologies:
7.
First technologies:
CSS, Gravatar, Html,
Number of used javascripts: 7.
First javascripts:
Gprofiles.js, Wpgroho.js, Jquery.autoresize.js,
Number of used analytics tools:
1.
First analytics tools:
ComScore,
Its server type is:
nginx.
Its CMS is:
Wordpress.
Technologies in use by Amtonberg.com
Technology
Number of occurences: 7
- CSS
- Gravatar
- Html
- Html5
- Javascript
- Php
- Pingback
Advertisement
Javascripts
Number of occurences: 7
- gprofiles.js
- wpgroho.js
- jquery.autoresize.js
- script.js
- form.js
- 725X1342.skimlinks.js
- w.js
Content Management System
Number of occurences: 1
- Wordpress
Analytics
Number of occurences: 1
- comScore
Advertise
Number of occurences: 1
- Skimlinks
Server Type
- nginx
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Not founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Not founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Amtonberg.com
SSL certificate
- name: /CN=tls.automattic.com
- subject:
- CN: tls.automattic.com
- hash: 6338c477
- issuer:
- C: US
- O: Let's Encrypt
- CN: Let's Encrypt Authority X3
- version: 2
- serialNumber: 305824697402169823231304834028145237636840
- validFrom: 160404105900Z
- validTo: 160703105900Z
- validFrom_time_t: 1459767540
- validTo_time_t: 1467543540
- extensions:
- keyUsage: Digital Signature, Key Encipherment
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- basicConstraints: CA:FALSE
- subjectKeyIdentifier: 87:31:32:E9:5B:BB:9F:C8:1F:62:6D:1C:ED:86:04:10:53:63:F0:5B
- authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
- authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
- subjectAltName: DNS:amsterdampornguide.com, DNS:amsterdamprivateboattour.com, DNS:amsterdamrxp.com, DNS:amsterdamsel.com, DNS:amsterdamspurs.com, DNS:amsterdamwhitneygallery.com, DNS:amsterdogblog.com, DNS:amsthinktank.com, DNS:amstohr.com, DNS:amsuganda.org, DNS:amtaes-asociacion.com, DNS:amtales.com, DNS:amtastudentblog.com, DNS:amtaxidermy.com, DNS:amtayouradvantage.com, DNS:amtbvancouver.com, DNS:amtea.net, DNS:amtextilesolutions.com, DNS:amtfdizi.com, DNS:amtgala.com, DNS:amth.org, DNS:amthirdpartyreport.com, DNS:amthompson.net, DNS:amtice.com, DNS:amtlecolemusique.com, DNS:amtlive.org, DNS:amtlpaul.com, DNS:amtonberg.com, DNS:amtphotographynyc.com, DNS:amtrakcareersnewsletter.com, DNS:amtrakmarketfridaysweepstakes.com, DNS:amtraknews.com, DNS:amtraveltimes.com, DNS:amtup.net, DNS:amtuusimaa.net, DNS:amtzweinull.com, DNS:amuciq.org, DNS:amuddylife.com, DNS:amuddymess.com, DNS:amughalffull.com, DNS:amulet-project.org, DNS:amulethunter.com, DNS:amuletsbymerlin.me, DNS:amuletstrange.com, DNS:amulmago.com, DNS:amulyabodden.com, DNS:amulyadatla.com, DNS:amulyagopalakrishnan.com, DNS:amumandotherthings.com, DNS:amumediation.com, DNS:tls.automattic.com
- certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/
Number of occurences: 12
- Name:
Content: https://www.facebook.com/WordPresscom - Name: generator
Content: WordPress.com - Name: twitter:site
Content: @wordpressdotcom - Name: twitter:image
Content: https://secure.gravatar.com/blavatar/039a06d705102f473df054e607e7f905?s=240 - Name: twitter:card
Content: summary - Name: theme-color
Content: #1b2b4f - Name: application-name
Content: Am Tonberg - Reiseblog - Name: msapplication-window
Content: width=device-width;height=device-height - Name: msapplication-tooltip
Content: ...mit der Familie unterwegs - Name: msapplication-task
Content: name=WordPress.com-Foren;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico - Name: title
Content: Willkommen | Am Tonberg - Reiseblog bei WordPress.com - Name: description
Content: Auf den folgenden Seiten haben wir einige unserer Urlaubsreisen dokumentiert. 2016 Breslau, Krakau, Zakopane (PL) 2015 Lago di Garda und Milano (I) Andalusien (E) 2014 Istanbul (TR) London und Edinburgh (GB) 2012 Wien (A) Prag (CZ) Paris (F) Weitere Reiseziele stehen rechts unter "Destinations"
Server / Hosting
- IP: 192.0.78.24
- Latitude: 37.75
- Longitude: -122.42
- Country: United States
- City: San Francisco
Rname
- ns1.wordpress.com
- ns2.wordpress.com
- ns3.wordpress.com
Target
- hostmaster.wordpress.com
HTTP Header Response
HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Wed, 27 Apr 2016 17:00:19 GMT
Content-Type: text/html
Content-Length: 178
Connection: keep-alive
Location: https://amtonberg.com/
X-ac: 3.ams _dca
HTTP/1.1 200 OK
Server: nginx
Date: Wed, 27 Apr 2016 17:00:19 GMT
Content-Type: text/html; charset=UTF-8
Connection: keep-alive
Strict-Transport-Security: max-age=86400
Vary: Accept-Encoding
Vary: Cookie
X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
X-Pingback: https://amtonberg.com/xmlrpc.php
Link: ; rel=shortlink
X-ac: 3.ams _dca
DNS
host: amtonberg.com
- class: IN
- ttl: 298
- type: A
- ip: 192.0.78.25
host: amtonberg.com
- class: IN
- ttl: 298
- type: A
- ip: 192.0.78.24
host: amtonberg.com
- class: IN
- ttl: 86400
- type: NS
- target: ns1.wordpress.com
host: amtonberg.com
- class: IN
- ttl: 86400
- type: NS
- target: ns2.wordpress.com
host: amtonberg.com
- class: IN
- ttl: 86400
- type: NS
- target: ns3.wordpress.com
host: amtonberg.com
- class: IN
- ttl: 86400
- type: SOA
- mname: ns1.wordpress.com
- rname: hostmaster.wordpress.com
- serial: 2005071858
- refresh: 14400
- retry: 7200
- expire: 604800
- minimum-ttl: 300
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.mtonberg.com, www.aomtonberg.com, www.omtonberg.com, www.apmtonberg.com, www.pmtonberg.com, www.a9mtonberg.com, www.9mtonberg.com, www.amtonberg.com, www.mtonberg.com, www.aimtonberg.com, www.imtonberg.com, www.aumtonberg.com, www.umtonberg.com, www.atonberg.com, www.amptonberg.com, www.aptonberg.com, www.amotonberg.com, www.aotonberg.com, www.amitonberg.com, www.aitonberg.com, www.amktonberg.com, www.aktonberg.com, www.am.tonberg.com, www.a.tonberg.com, www.amutonberg.com, www.autonberg.com, www.amjtonberg.com, www.ajtonberg.com, www.amntonberg.com, www.antonberg.com, www.am-tonberg.com, www.a-tonberg.com, www.amonberg.com, www.amtqonberg.com, www.amqonberg.com, www.amtaonberg.com, www.amaonberg.com, www.amt onberg.com, www.am onberg.com, www.amtwonberg.com, www.amwonberg.com, www.amteonberg.com, www.ameonberg.com, www.amtzonberg.com, www.amzonberg.com, www.amtxonberg.com, www.amxonberg.com, www.amtconberg.com, www.amconberg.com, www.amtnberg.com, www.amtobnberg.com, www.amtbnberg.com, www.amtohnberg.com, www.amthnberg.com, www.amtognberg.com, www.amtgnberg.com, www.amtojnberg.com, www.amtjnberg.com, www.amtomnberg.com, www.amtmnberg.com, www.amto nberg.com, www.amt nberg.com, www.amtovnberg.com, www.amtvnberg.com, www.amtoberg.com, www.amtonnberg.com, www.amtonberg.com, www.amtonhberg.com, www.amtohberg.com, www.amtonjberg.com, www.amtojberg.com, www.amtonkberg.com, www.amtokberg.com, www.amtonlberg.com, www.amtolberg.com, www.amton berg.com, www.amto berg.com, www.amtonerg.com, www.amtonbqerg.com, www.amtonqerg.com, www.amtonbwerg.com, www.amtonwerg.com, www.amtonbzerg.com, www.amtonzerg.com, www.amtonbxerg.com, www.amtonxerg.com, www.amtonberg.com, www.amtonerg.com, www.amtonbserg.com, www.amtonserg.com, www.amtonbyerg.com, www.amtonyerg.com, www.amtonbeerg.com, www.amtoneerg.com, www.amtonbderg.com, www.amtonderg.com, www.amtonbcerg.com, www.amtoncerg.com, www.amtonbrg.com, www.amtonbexrg.com, www.amtonbxrg.com, www.amtonbesrg.com, www.amtonbsrg.com, www.amtonbewrg.com, www.amtonbwrg.com, www.amtonberrg.com, www.amtonbrrg.com, www.amtonbefrg.com, www.amtonbfrg.com, www.amtonbevrg.com, www.amtonbvrg.com, www.amtonbecrg.com, www.amtonbcrg.com, www.amtonbeqrg.com, www.amtonbqrg.com, www.amtonbearg.com, www.amtonbarg.com, www.amtonbeyrg.com, www.amtonbyrg.com, www.amtonbeg.com, www.amtonberig.com, www.amtonbeig.com, www.amtonberog.com, www.amtonbeog.com, www.amtonberlg.com, www.amtonbelg.com, www.amtonberlg.com, www.amtonbelg.com, www.amtonber.g.com, www.amtonbe.g.com, www.amtonber.com, www.amtonbergs.com, www.amtonbers.com, www.amtonbergx.com, www.amtonberx.com, www.amtonbergy.com, www.amtonbery.com, www.amtonbergh.com, www.amtonberh.com, www.amtonbergn.com, www.amtonbern.com, www.amtonbergc.com, www.amtonberc.com, www.amtonbergd.com, www.amtonberd.com, www.amtonberge.com, www.amtonbere.com, www.amtonbergr.com, www.amtonberr.com, www.amtonbergt.com, www.amtonbert.com, www.amtonbergb.com, www.amtonberb.com, www.amtonbergv.com, www.amtonberv.com,
Other websites we recently analyzed
- Fashion Tips And Advice
The market and styles of sunglasses are driven by popular fashion and show biz world. In fact as soon as a pair is worn by a celebrity it is a sure way ofHouston (United States) - 192.185.160.62
Server software: nginx/1.10.1
Technology: Google Adsense, CSS, Html, Javascript, jQuery, Php, Pingback, Wordpress
Number of Javascript: 11
Number of meta tags: 7 - shengsibank.com
See related links to what you are looking for.New York (United States) - 199.59.243.120
Server software: Microsoft-IIS/7.5
Technology: Google Adsense, Html, Html5, Javascript
Number of meta tags: 3 - Lost Places
Interesting, abandoned, lonely and horrorful places all over the world. Submit your places!New York (United States) - 66.6.43.21
Server software: nginx
Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, Php, Google Analytics, Tumblr, Facebook Like box
Number of Javascript: 3
Number of meta tags: 23 - Karizma Builders
Scottsdale (United States) - 166.62.28.125
Server software: Apache/2.4.12
Technology: CSS, Html
Number of meta tags: 1 - www.praxis-dr-senska.de
Hamburg (Germany) - 212.53.129.8
Server software: Apache
Technology: Html
Number of meta tags: 1 - Gold Coast Carpet Clean
Australia - 27.124.120.1
Server software: nginx
Technology: CSS, Html, Javascript
Number of meta tags: 1 - AKME Ingénierie
Akme ingénierie Versailles Maurepas ile de FranceFrance - 62.210.16.62
Server software: nginx
Technology: CSS, Html, Javascript
Number of Javascript: 5
Number of meta tags: 4 - goaltriggerapp.com
Wayne (United States) - 74.208.215.69
Server software: Apache
Technology: Html
Number of meta tags: 1 - Willkommen bei Ruhmann.de
Germany - 31.170.104.133
Server software: Apache/2.2.31
Technology: CSS, Html, Php
Number of meta tags: 1 - elenamatematicas.es - Diese Website steht zum Verkauf! - Informationen zum Thema elenamatematicas.
Diese Website steht zum Verkauf! elenamatematicas.es ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf elenamatematicas.es alles. Wir hoffen, dass Sie hier das Gesuchte finden!Cambridge (United States) - 72.52.4.119
Server software: Apache/2.2.22 (Debian)
Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
Number of Javascript: 4
Number of meta tags: 5